PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 279aa    MW: 31898.1 Da    PI: 6.8476
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34991.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78.2e-082282612154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp+++++++L +++gL+ +q+ +WF N+R +
  KHN34991.1 228 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 261
                 469*****************************87 PP

2ELK25.62.9e-09182203122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK +L++++++++ ++++E++
  KHN34991.1 182 ELKIELKQGFKSRIEDVREEIL 203
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-191862IPR005540KNOX1
PfamPF037901.2E-172061IPR005540KNOX1
SMARTSM012568.8E-2273128IPR005541KNOX2
PfamPF037918.0E-1776127IPR005541KNOX2
PROSITE profilePS512139.132182202IPR005539ELK domain
PROSITE profilePS5007111.71202265IPR001356Homeobox domain
SMARTSM003895.3E-11204269IPR001356Homeobox domain
SuperFamilySSF466892.87E-16204269IPR009057Homeodomain-like
CDDcd000868.12E-12205266No hitNo description
Gene3DG3DSA:1.10.10.603.7E-25209267IPR009057Homeodomain-like
PfamPF059209.8E-18222261IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MQEAGLGMMG EVSGDQHRQL KAEIATHPLY EQLLAAHVAC LRVATPIDQL PLIDAQLSQS  60
HHLLRSYVSH NTLSLSPHHR QELDNFLAQY LIVLCTFKEQ LQQHVRVHAV EAVMACRDIE  120
NTLQALTGVS LGEGTGATMS DDEDDLQMDF SLDQSSAEGH DMMGFGLPTE SERSLMERVR  180
QELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTSVLK NWWQQHAKWP YPTEDDKAKL  240
VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-13205261864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258278RKRNWHSNSQSVTSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0950030.0BT095003.1 Soybean clone JCVI-FLGm-6F23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538444.10.0PREDICTED: homeobox protein HD1
SwissprotQ9FPQ81e-170KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A0B2RK780.0A0A0B2RK78_GLYSO; Homeobox protein knotted-1-like 7
TrEMBLA0A0R0HAW90.0A0A0R0HAW9_SOYBN; Uncharacterized protein
STRINGGLYMA11G02960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-171KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]